money.png

7 Promises To My Son - Huffington Post

road morning trees mist ontario canada fog forest dark maple scary path run conceptual lightbeams saultstemarie frightening pancakebay
Photo by Billy Wilson Photography on Flickr
More and more women are freely making choices to construct a life born from choice, not obligation or expectation. As a mother and feminist, I am proud to raise my daughter in a country that, lately, is as concerned (almost obsessed) with equality in education, health care, athletics and compensation as I am. I get giddy watching the world open up for. via www.huffingtonpost.com

7 kitchen skills kids need before they leave for college - Columbia Daily Tribune

theotherway1969 midwood35196 95cents theotherwayroberthadley strangefascinationgreghamilton twonewnovelsaboutwomen intheshadowworldoflove themiamiherald themiamiheraldlivingfood leftoverricemakesalastminutemeal postedonthursday042513 bysaramoultonassociatedpress shrimpfriedricewithpickledradishes matthewmeadap ilovefriedricenotonlyforitstasteandversatility butalsobecauseit’ssoeasytomakeatthelastminute ialmostalwayshavemostofthecoreingredientsstockedinmypantryrefrigeratorandfreezer ifacartonofleftovertakeoutrestaurantricesuddenlyappears onashelfnexttothemilki’mgoodtogo proteinwisethisrecipecallsforshrimp butyoucanuseanyproteinyouchoose ortossinmushroomsinsteadandcallitavegetarian’sdelight asistypicalinchinesecuisinethisdishrequireslittlecookingtime butyoumusthavealltheingredientsmeasuredandchoppedbeforeyoutosstheminthepan intheendicanprettymuchguaranteethatifyoutrythisrecipeevenonce you’llbeinspiredtomakeitagainandagain changingitslightlyeverytimetomakeroom forwhicheverdeliciousseasonalingredientshappentobeathand orwhicheverleftoversarecryingouttobeusedup fsunews commonsenseplanningmakeasafercampus beintheknowwithfsuguardian thenightnoleandmoreprotectionfromfsupd writtenbybrittanylyonsstaffwriterbhl11lyons thebluelighttrailisoneofthenumerousprecautionsfloridastate hasimplementedtoincreasecampussafety zacharygoldsteinfsview incomingstudentsshouldbeawareoftheemergencybluelightsystem whichfunctionsasameansofcontactingfsupdforimmediateassistance thereareover400ofthesebluelighttelephonesthroughoutcampus sonotingtheirlocationsisawaytobereadyincaseofanemergency inadditionstudentsthatprovidetheircellphonenumbers willbeabletoreceiveemergencynotificationsthroughfsualert anduniversitypoliceofferafreenewservicecalledfsuguardian —ifyousignupanemergencycallfromyourcellphone wouldallowfsupdtohavequickaccesstoyourinformation aswellasgpscoordinatesofyourlocation inordertohelpthemrespondmorequickly lieutenanthankjacoboffsupd’ssupportservicesdivision advisesstudentstorecordtheserialnumbersoftheirvaluables accordingtojacobthisinformationisespeciallyvaluable ifpropertyendsupatapawnshoporadvertisedoncraigslist alotofitiscommonsensejacobsaid oneofthebiggestthingswegetispeopleleavingtheirstuffaround youcan’texpectittobetherewhenyougetback youcan’tleaveyourresidencehallunlockedoryourcarunlocked youhavetodothemostyoucantosecureandsafeguardyourproperty finallyjacobofferedadviceonhowtostaysafeandberesponsibleatfsu don’tbreakthelawjacobsaid don’tdrinkdon’tdopotdon’tbesotrustingornaïve importantphonenumbers fsupdemergencysituation911 fsupdurgentsituation311 safeconnection6447233 gettheskinnyontallahasseenaturally jun262013756pm writtenbytammylnoelcustomcontenteditor takingminimalismtotheextremecustomcontenteditortammynoelthrowsfashion andherclothestothewindinfavorofnudenaturism tammynoelandkatiedolciatofsview thefullmoonskinnydipisaflyereasilyrecognizableflyeraroundcampus sheddingfreeofthatrestrictivematerialmayallowustowitnessaclaritythatwewouldn’tnormallysee wellineededsomeclarity tomeit’sawayofgettingintouchwithancestralroots thisisthewaypeoplewereforthousandsandthousandsofyears—connectedwithallofhistory
Photo by marsmet525 on Flickr
When our oldest child left for college last fall, I knew I would miss him terribly. I was happy to call him weekly, but I wasn’t sure what might prompt him to initiate a call or text. When he left for. via www.columbiatribune.com

Community Calendar for the week of July 28 - Sierra Star

aprilfools
Photo by colorblindPICASO on Flickr
Mountain Ministerial Association and Friends in the Park sponsoring this weekly event through August. Rotating pastors and worship music bands leading Christian worship services. Community Park at Civic Circle Dr. , Oakhurst. via www.sierrastar.com

Latest News

  • Huffington Post Huffington Post

    7 Promises To My Son

    Huffington Post - 07/26/16

    Knowing how to change a tire, understand your credit score, make pancakes, do laundry, unclog a drain and sew on a button are important life skills. I want you to have an understanding of traditional male and female roles in the house, because you won

  • Columbia Daily Tribune Columbia Daily Tribune

    7 kitchen skills kids need before they leave for college

    Columbia Daily Tribune - 07/26/16

    If we teach our kids how to plan in advance for a meal or two, figure out what to serve to make a complete and nutritious dinner, make a grocery list and shop, and know when to start cooking each dish so they will all be ready at the same time, they

  • Huffington Post Huffington Post

    5 Genius Ways To Get The Last Bits Of Peanut Butter Out Of The Jar

    Huffington Post - 07/26/16

    It adds protein to our pancakes. It offers a quick lunch. It even makes a great addition to dessert. Basically, we can't live without the stuff. That's why we don't toss the nearly-empty jar when there are just bits of peanut butter stubbornly hiding

  • St. Cloud Times St. Cloud Times

    Beyond the bread: 8 ways to get creative with zucchini

    St. Cloud Times - 07/26/16

    It's comical, but it's also a dilemma; a person can only make (and eat!) so much zucchini bread. Whether you're a zucchini grower Healthy zucchini pancakes. Zucchini for breakfast? You heard that right. Zucchini adds a healthy twist to these fluffy

  • Sierra Star

    Community Calendar for the week of July 28

    Sierra Star - 07/26/16

    Senior Center Bingo: 12 noon Every Thursday and First two Saturdays; 49111 Cinder Lane - behind the Community Center, Oakhurst. Details: (559) 658-2200. Vision Academy - Senior Center: 12 noon . FUNDRAISERS. Pancake Breakfast : 7 a.m. - 11 a.m. Last

Leave a Comment

Fields with * are required.